PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G065600.1
Common NamePHAVU_007G065600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 111aa    MW: 12777.7 Da    PI: 9.4555
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G065600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.25.8e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+ie+ + rqvtfskRrng+lKKA+ELSvLCda+vavi+f+++g+lye+ss
  Phvul.007G065600.1  9 KKIEDATSRQVTFSKRRNGLLKKAYELSVLCDAQVAVIVFAQNGRLYEFSS 59
                        68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.104161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-32374IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.13E-42375No hitNo description
PfamPF003194.5E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-303859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MVRGKVQMKK IEDATSRQVT FSKRRNGLLK KAYELSVLCD AQVAVIVFAQ NGRLYEFSSC  60
DMSKILERYS QYTKDVPANK LGDDYIQNLE RRRTLFVWES SQDEQFLVVG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-24192191Myocyte-specific enhancer factor 2B
1tqe_Q3e-24192191Myocyte-specific enhancer factor 2B
1tqe_R3e-24192191Myocyte-specific enhancer factor 2B
1tqe_S3e-24192191Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143357.15e-77hypothetical protein PHAVU_007G065600g
SwissprotQ9FIS14e-40AGL42_ARATH; MADS-box protein AGL42
TrEMBLV7BFT26e-77V7BFT2_PHAVU; Uncharacterized protein
STRINGGLYMA10G38541.19e-50(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.42e-41AGAMOUS-like 42